PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10002556m
Common NameCARUB_v10002556mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family MYB
Protein Properties Length: 267aa    MW: 30781.7 Da    PI: 6.3502
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10002556mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding40.85.2e-131461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT eEd +l + +   G ++W+ +++  g+ R++k+c++rw +yl
  Carubv10002556m 14 RGPWTIEEDHRLMNFILNNGIHCWRIVPKLAGLLRCGKSCRLRWINYL 61
                     89******************************99************97 PP

2Myb_DNA-binding51.91.7e-1667110146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg +T  E++++ +++ qlG++ W++Ia+++  gRt++++k++w++
  Carubv10002556m  67 RGGFTDAEEDRIMELHSQLGNR-WSKIASHFS-GRTDNEIKNHWNT 110
                      788*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.1E-20564IPR009057Homeodomain-like
PROSITE profilePS5129413.605961IPR017930Myb domain
SuperFamilySSF466891.61E-2711108IPR009057Homeodomain-like
SMARTSM007171.1E-51363IPR001005SANT/Myb domain
PfamPF002493.2E-111461IPR001005SANT/Myb domain
CDDcd001679.75E-41661No hitNo description
PROSITE profilePS5129425.12762116IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.2E-2565117IPR009057Homeodomain-like
SMARTSM007175.6E-1466114IPR001005SANT/Myb domain
PfamPF002494.5E-1467110IPR001005SANT/Myb domain
CDDcd001678.00E-970110No hitNo description
Gene3DG3DSA:3.40.50.3007.5E-4157223IPR027417P-loop containing nucleoside triphosphate hydrolase
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 267 aa     Download sequence    Send to blast
MGRKPCCEKI GLKRGPWTIE EDHRLMNFIL NNGIHCWRIV PKLAGLLRCG KSCRLRWINY  60
LRPDLKRGGF TDAEEDRIME LHSQLGNRWS KIASHFSGRT DNEIKNHWNT KIKKKMKHLG  120
LDPATHKPMN NITHQTDPNH QDTKPKMCSS INNEGEEMKD QTPKDDVIKE TAKALTDNNE  180
ELVEKNWKNL RAEEVDLESL FETQGNEISS NSSISSLYSN ISRNESSSYL AEDSISLEQW  240
DLDMTDPFVP WDLFAANLDH DNLFFL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-26121165108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00510DAPTransfer from AT5G14340Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY5196220.0AY519622.1 Arabidopsis thaliana MYB transcription factor (At5g14340) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006289133.10.0hypothetical protein CARUB_v10002556mg
TrEMBLR0FJ110.0R0FJ11_9BRAS; Uncharacterized protein
STRINGAT5G14340.11e-154(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G14340.11e-153myb domain protein 40